Lineage for d2c2ha1 (2c2h A:3-177)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867612Protein Rac3 [142255] (1 species)
  7. 2867613Species Human (Homo sapiens) [TaxId:9606] [142256] (1 PDB entry)
    Uniprot P60763 3-177
  8. 2867614Domain d2c2ha1: 2c2h A:3-177 [129668]
    Other proteins in same PDB: d2c2hb_
    complexed with ca, gdp, mg, so4

Details for d2c2ha1

PDB Entry: 2c2h (more details), 1.85 Å

PDB Description: crystal structure of the human rac3 in complex with gdp
PDB Compounds: (A:) ras-related c3 botulinum toxin substrate 3

SCOPe Domain Sequences for d2c2ha1:

Sequence, based on SEQRES records: (download)

>d2c2ha1 c.37.1.8 (A:3-177) Rac3 {Human (Homo sapiens) [TaxId: 9606]}
aikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtagqe
dydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlrdd
kdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavl

Sequence, based on observed residues (ATOM records): (download)

>d2c2ha1 c.37.1.8 (A:3-177) Rac3 {Human (Homo sapiens) [TaxId: 9606]}
aikcvvvgdgavgktcllisyttnafpgdnysanvmvdgkpvnlglwdtagqedydrlrp
lsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlrddkdtierl
rdkklapitypqglamareigsvkylecsaltqrglktvfdeairavl

SCOPe Domain Coordinates for d2c2ha1:

Click to download the PDB-style file with coordinates for d2c2ha1.
(The format of our PDB-style files is described here.)

Timeline for d2c2ha1: