SCOPe 2.07: Domain d2c2hb_: 2c2h B:

Lineage for d2c2hb_ (2c2h B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (34 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (286 PDB entries)

8. Domain d2c2hb_: 2c2h B: [129669]
   Other proteins in same PDB: d2c2ha1
   automated match to d1foeb_
   complexed with ca, gdp, mg, so4

Details for d2c2hb_

PDB Entry: 2c2h, 1.85 Å

PDB Description: crystal structure of the human rac3 in complex with gdp

PDB Compounds: (B:) ras-related c3 botulinum toxin substrate 3

SCOPe Domain Sequences for d2c2hb_:

Sequence, based on SEQRES records:

>d2c2hb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdgavgktcllisyttnafpgeyiptvfdnysanvmvdgkpvnlglwdtag
qedydrlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlr
ddkdtierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavl

Sequence, based on observed residues (ATOM records):

>d2c2hb_ c.37.1.8 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqaikcvvvgdgavgktcllisyttnafpgeyidnysanvmvdgkpvnlglwdtagqedy
drlrplsypqtdvflicfslvspasfenvrakwypevrhhcphtpillvgtkldlrddkd
tierlrdkklapitypqglamareigsvkylecsaltqrglktvfdeairavl

Timeline for d2c2hb_:

• d2c2hb_ first appeared in SCOP 1.73, called d2c2hb1
  
• d2c2hb_ appears in SCOPe 2.06
  
• d2c2hb_ appears in the current release, SCOPe 2.08