Lineage for d2c2aa2 (2c2a A:321-481)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537568Family d.122.1.3: Histidine kinase [55884] (8 proteins)
  6. 2537607Protein Sensor histidine kinase TM0853 [143795] (1 species)
  7. 2537608Species Thermotoga maritima [TaxId:2336] [143796] (1 PDB entry)
    Uniprot Q9WZV7 321-481
  8. 2537609Domain d2c2aa2: 2c2a A:321-481 [129663]
    Other proteins in same PDB: d2c2aa1
    complexed with adp, so4

Details for d2c2aa2

PDB Entry: 2c2a (more details), 1.9 Å

PDB Description: structure of the entire cytoplasmic portion of a sensor histidine kinase protein
PDB Compounds: (A:) sensor histidine kinase

SCOPe Domain Sequences for d2c2aa2:

Sequence, based on SEQRES records: (download)

>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]}
qinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpveayidptrirqvllnllnn
gvkyskkdapdkyvkvildekdggvliivedngigipdhakdrifeqfyrvdssltyevp
gtglglaitkeivelhggriwvesevgkgsrffvwipkdra

Sequence, based on observed residues (ATOM records): (download)

>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]}
qinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpveayidptrirqvllnllnn
gvkyskkdapdkyvkvildekdggvliivedngigipdhakdrifeqfyrvdtglglait
keivelhggriwvesevgkgsrffvwipkdra

SCOPe Domain Coordinates for d2c2aa2:

Click to download the PDB-style file with coordinates for d2c2aa2.
(The format of our PDB-style files is described here.)

Timeline for d2c2aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c2aa1