Lineage for d2c2aa2 (2c2a A:321-481)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732553Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 732554Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) (S)
  5. 732704Family d.122.1.3: Histidine kinase [55884] (7 proteins)
  6. 732743Protein Sensor histidine kinase TM0853 [143795] (1 species)
  7. 732744Species Thermotoga maritima [TaxId:2336] [143796] (1 PDB entry)
  8. 732745Domain d2c2aa2: 2c2a A:321-481 [129663]
    Other proteins in same PDB: d2c2aa1
    complexed with adp, so4

Details for d2c2aa2

PDB Entry: 2c2a (more details), 1.9 Å

PDB Description: structure of the entire cytoplasmic portion of a sensor histidine kinase protein
PDB Compounds: (A:) sensor histidine kinase

SCOP Domain Sequences for d2c2aa2:

Sequence, based on SEQRES records: (download)

>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]}
qinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpveayidptrirqvllnllnn
gvkyskkdapdkyvkvildekdggvliivedngigipdhakdrifeqfyrvdssltyevp
gtglglaitkeivelhggriwvesevgkgsrffvwipkdra

Sequence, based on observed residues (ATOM records): (download)

>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]}
qinrekvdlcdlvesavnaikefasshnvnvlfesnvpcpveayidptrirqvllnllnn
gvkyskkdapdkyvkvildekdggvliivedngigipdhakdrifeqfyrvdtglglait
keivelhggriwvesevgkgsrffvwipkdra

SCOP Domain Coordinates for d2c2aa2:

Click to download the PDB-style file with coordinates for d2c2aa2.
(The format of our PDB-style files is described here.)

Timeline for d2c2aa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c2aa1