SCOPe 2.08: Domain d2c2aa1: 2c2a A:232-320

Lineage for d2c2aa1 (2c2a A:232-320)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.30: ROP-like [47379] (8 superfamilies)
   4 helices; dimer of identical alpha-hairpin subunits; bundle, closed, left-handed twist

4. Superfamily a.30.2: Homodimeric domain of signal transducing histidine kinase [47384] (2 families)

5. Family a.30.2.1: Homodimeric domain of signal transducing histidine kinase [47385] (4 proteins)

6. Protein Sensor histidine kinase TM0853 [140494] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [140495] (1 PDB entry)
   Uniprot Q9WZV7 232-320

8. Domain d2c2aa1: 2c2a A:232-320 [129662]
   Other proteins in same PDB: d2c2aa2
   complexed with adp, so4

Details for d2c2aa1

PDB Entry: 2c2a, 1.9 Å

PDB Description: structure of the entire cytoplasmic portion of a sensor histidine kinase protein

PDB Compounds: (A:) sensor histidine kinase

SCOPe Domain Sequences for d2c2aa1:

Sequence; same for both SEQRES and ATOM records:

>d2c2aa1 a.30.2.1 (A:232-320) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]}
menvteskelerlkridrmktefianishelrtpltaikayaetiynslgeldlstlkef
leviidqsnhlenllnelldfsrlerksl

Timeline for d2c2aa1:

• d2c2aa1 first appeared in SCOP 1.73
  
• d2c2aa1 appears in SCOPe 2.07