PDB entry 2c2a

View 2c2a on RCSB PDB site
Description: structure of the entire cytoplasmic portion of a sensor histidine kinase protein
Class: transferase
Keywords: histidine kinase, phosphotransfer, phoq, selenomethionyl mad, two-component systems, transferase
Deposited on 2005-09-27, released 2005-11-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2465
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sensor histidine kinase
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C2A (0-0)
    • Uniprot Q9WZV7 (1-End)
    Domains in SCOPe 2.08: d2c2aa1, d2c2aa2
  • Heterogens: ADP, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c2aA (A:)
    menvteskelerlkridrmktefianishelrtpltaikayaetiynslgeldlstlkef
    leviidqsnhlenllnelldfsrlerkslqinrekvdlcdlvesavnaikefasshnvnv
    lfesnvpcpveayidptrirqvllnllnngvkyskkdapdkyvkvildekdggvliived
    ngigipdhakdrifeqfyrvdssltyevpgtglglaitkeivelhggriwvesevgkgsr
    ffvwipkdragednrqdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2aA (A:)
    menvteskelerlkridrmktefianishelrtpltaikayaetiynslgeldlstlkef
    leviidqsnhlenllnelldfsrlerkslqinrekvdlcdlvesavnaikefasshnvnv
    lfesnvpcpveayidptrirqvllnllnngvkyskkdapdkyvkvildekdggvliived
    ngigipdhakdrifeqfyrvdtglglaitkeivelhggriwvesevgkgsrffvwipkdr
    a