Class a: All alpha proteins [46456] (290 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.7: 14-3-3 protein [48445] (1 family) automatically mapped to Pfam PF00244 |
Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
Protein automated matches [190238] (11 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries) |
Domain d2c1na_: 2c1n A: [129640] automated match to d1qjba_ |
PDB Entry: 2c1n (more details), 2 Å
SCOPe Domain Sequences for d2c1na_:
Sequence, based on SEQRES records: (download)
>d2c1na_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
>d2c1na_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk mkgdyyrylaevakgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyeilnsp ekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
Timeline for d2c1na_: