Lineage for d2c1na1 (2c1n A:1-230)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647251Superfamily a.118.7: 14-3-3 protein [48445] (1 family) (S)
  5. 647252Family a.118.7.1: 14-3-3 protein [48446] (2 proteins)
  6. 647261Protein zeta isoform [48449] (2 species)
  7. 647271Species Human (Homo sapiens) [TaxId:9606] [48451] (5 PDB entries)
  8. 647276Domain d2c1na1: 2c1n A:1-230 [129640]
    automatically matched to d1qjba_

Details for d2c1na1

PDB Entry: 2c1n (more details), 2 Å

PDB Description: molecular basis for the recognition of phosphorylated and phosphoacetylated histone h3 by 14-3-3
PDB Compounds: (A:) 14-3-3 protein zeta/delta

SCOP Domain Sequences for d2c1na1:

Sequence, based on SEQRES records: (download)

>d2c1na1 a.118.7.1 (A:1-230) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

Sequence, based on observed residues (ATOM records): (download)

>d2c1na1 a.118.7.1 (A:1-230) zeta isoform {Human (Homo sapiens) [TaxId: 9606]}
mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
mkgdyyrylaevakgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyeilnsp
ekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts

SCOP Domain Coordinates for d2c1na1:

Click to download the PDB-style file with coordinates for d2c1na1.
(The format of our PDB-style files is described here.)

Timeline for d2c1na1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2c1nb1