Lineage for d2byma_ (2bym A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2699133Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 2699140Protein Chrac-16 [140400] (1 species)
  7. 2699141Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140401] (2 PDB entries)
    Uniprot Q9V452 29-100
  8. 2699144Domain d2byma_: 2bym A: [129493]
    Other proteins in same PDB: d2bymb_, d2bymd_
    automated match to d2byka1
    protein/DNA complex; complexed with cd

Details for d2byma_

PDB Entry: 2bym (more details), 2.8 Å

PDB Description: histone fold heterodimer of the chromatin accessibility complex
PDB Compounds: (A:) chrac-16

SCOPe Domain Sequences for d2byma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2byma_ a.22.1.3 (A:) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tglitnevlflmtkctelfvrhlagaayteefgqrpgealkyehlsqvvnknknlefllq
ivpqk

SCOPe Domain Coordinates for d2byma_:

Click to download the PDB-style file with coordinates for d2byma_.
(The format of our PDB-style files is described here.)

Timeline for d2byma_: