![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins) |
![]() | Protein Chrac-14 [140398] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140399] (2 PDB entries) Uniprot Q9V444 11-99 |
![]() | Domain d2bymb_: 2bym B: [129494] Other proteins in same PDB: d2byma_, d2bymc_ automated match to d2bykb1 protein/DNA complex; complexed with cd |
PDB Entry: 2bym (more details), 2.8 Å
SCOPe Domain Sequences for d2bymb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bymb_ a.22.1.3 (B:) Chrac-14 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} avigrlikealpesasvskearaaiaraasvfaifvtssstalahkqnhktitakdilqt lteldfesfvpsltqdlevyrkv
Timeline for d2bymb_: