![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins) formerly omega-Aminoacid:pyruvate aminotransferase-like |
![]() | Protein Ornithine aminotransferase [53422] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [53423] (11 PDB entries) |
![]() | Domain d2byla1: 2byl A:36-439 [129490] complexed with plp; mutant |
PDB Entry: 2byl (more details), 2.15 Å
SCOPe Domain Sequences for d2byla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} gpptsddifereykygahnahplpvalergkgiylwdvegrkyfdflssisavnqghchp kivnalksqvdkltltsrafynnvlgeyeeyitklfnyhkvlpmntgveagetacklark wgytvkgiqkykakivfaagnfwgrtlsaissstdptsydgfgpfmpgfdiipyndlpal eralqdpnvaafmvepiqgeagvvvpdpgylmgvrelctrhqvlfiadeiqtglartgrw lavdyenvrpdivllgkalsgglypvsavlcdddimltikpgehfstyggnplgcrvaia alevleeenlaenadklgiilrnelmklpsdvvtavrgkgllnaiviketkdwdawkvcl rlrdngllakpthgdiirfapplvikedelresieiinktilsf
Timeline for d2byla1: