Lineage for d2byla1 (2byl A:36-439)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2471599Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2471753Protein Ornithine aminotransferase [53422] (3 species)
  7. 2471754Species Human (Homo sapiens) [TaxId:9606] [53423] (7 PDB entries)
  8. 2471755Domain d2byla1: 2byl A:36-439 [129490]
    complexed with plp; mutant

Details for d2byla1

PDB Entry: 2byl (more details), 2.15 Å

PDB Description: Structure of ornithine aminotransferase triple mutant Y85I Y55A G320F
PDB Compounds: (A:) ornithine aminotransferase

SCOPe Domain Sequences for d2byla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]}
gpptsddifereykygahnahplpvalergkgiylwdvegrkyfdflssisavnqghchp
kivnalksqvdkltltsrafynnvlgeyeeyitklfnyhkvlpmntgveagetacklark
wgytvkgiqkykakivfaagnfwgrtlsaissstdptsydgfgpfmpgfdiipyndlpal
eralqdpnvaafmvepiqgeagvvvpdpgylmgvrelctrhqvlfiadeiqtglartgrw
lavdyenvrpdivllgkalsgglypvsavlcdddimltikpgehfstyggnplgcrvaia
alevleeenlaenadklgiilrnelmklpsdvvtavrgkgllnaiviketkdwdawkvcl
rlrdngllakpthgdiirfapplvikedelresieiinktilsf

SCOPe Domain Coordinates for d2byla1:

Click to download the PDB-style file with coordinates for d2byla1.
(The format of our PDB-style files is described here.)

Timeline for d2byla1: