Lineage for d2bwbd_ (2bwb D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696033Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2696034Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2696138Protein automated matches [190533] (3 species)
    not a true protein
  7. 2696139Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187496] (3 PDB entries)
  8. 2696144Domain d2bwbd_: 2bwb D: [129332]
    automated match to d1wr1b1

Details for d2bwbd_

PDB Entry: 2bwb (more details), 2.3 Å

PDB Description: crystal structure of the uba domain of dsk2 from s. cerevisiae
PDB Compounds: (D:) ubiquitin-like protein dsk2

SCOPe Domain Sequences for d2bwbd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bwbd_ a.5.2.1 (D:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng

SCOPe Domain Coordinates for d2bwbd_:

Click to download the PDB-style file with coordinates for d2bwbd_.
(The format of our PDB-style files is described here.)

Timeline for d2bwbd_: