PDB entry 2bwb

View 2bwb on RCSB PDB site
Description: crystal structure of the uba domain of dsk2 from s. cerevisiae
Class: signaling protein
Keywords: ubiquitin, uba, signaling protein
Deposited on 2005-07-13, released 2006-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.246
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bwba_
  • Chain 'B':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bwbb_
  • Chain 'C':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bwbc_
  • Chain 'D':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bwbd_
  • Chain 'E':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bwbe_
  • Chain 'F':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bwbf_
  • Chain 'G':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bwbg_
  • Chain 'H':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bwbh_
  • Chain 'I':
    Compound: ubiquitin-like protein dsk2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2bwbi_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bwbA (A:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bwbB (B:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwbB (B:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldslln
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bwbC (C:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2bwbD (D:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwbD (D:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2bwbE (E:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwbE (E:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldslln
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2bwbF (F:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwbF (F:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldslln
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2bwbG (G:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwbG (G:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2bwbH (H:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwbH (H:)
    dpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldslln
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2bwbI (I:)
    ldpeeryehqlrqlndmgffdfdrnvaalrrsggsvqgaldsllng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bwbI (I:)
    dpeeryehqlrqlnfdfdrnvaalrrsggsvqgaldslln