Lineage for d2bs2e2 (2bs2 E:1-106)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2541095Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2541264Protein automated matches [231466] (5 species)
    not a true protein
  7. 2541306Species Wolinella succinogenes [TaxId:844] [255061] (1 PDB entry)
  8. 2541308Domain d2bs2e2: 2bs2 E:1-106 [129040]
    Other proteins in same PDB: d2bs2a1, d2bs2a2, d2bs2a3, d2bs2b1, d2bs2c_, d2bs2d1, d2bs2d2, d2bs2d3, d2bs2e1, d2bs2f_
    automated match to d2bs2e2
    complexed with f3s, fad, fes, fum, hem, lmt, na, sf4

Details for d2bs2e2

PDB Entry: 2bs2 (more details), 1.78 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (E:) quinol-fumarate reductase iron-sulfur subunit b

SCOPe Domain Sequences for d2bs2e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs2e2 d.15.4.2 (E:1-106) automated matches {Wolinella succinogenes [TaxId: 844]}
mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag
icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvd

SCOPe Domain Coordinates for d2bs2e2:

Click to download the PDB-style file with coordinates for d2bs2e2.
(The format of our PDB-style files is described here.)

Timeline for d2bs2e2: