SCOPe 2.07: Domain d2bs2c_: 2bs2 C:

Lineage for d2bs2c_ (2bs2 C:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (2 proteins)
   duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry

6. Protein automated matches [190227] (1 species)
   not a true protein

7. Species Wolinella succinogenes [TaxId:844] [186991] (3 PDB entries)

8. Domain d2bs2c_: 2bs2 C: [129035]
   Other proteins in same PDB: d2bs2a1, d2bs2a2, d2bs2a3, d2bs2b1, d2bs2b2, d2bs2d1, d2bs2d2, d2bs2d3, d2bs2e1, d2bs2e2
   automated match to d1e7pc_
   complexed with f3s, fad, fes, fum, hem, lmt, na, sf4

Details for d2bs2c_

PDB Entry: 2bs2, 1.78 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes

PDB Compounds: (C:) quinol-fumarate reductase diheme cytochrome b subunit c

SCOPe Domain Sequences for d2bs2c_:

Sequence; same for both SEQRES and ATOM records:

>d2bs2c_ f.21.2.1 (C:) automated matches {Wolinella succinogenes [TaxId: 844]}
mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
pnidykyfdykrthe

Timeline for d2bs2c_:

• d2bs2c_ first appeared in SCOP 1.73, called d2bs2c1
  
• d2bs2c_ appears in SCOPe 2.06
  
• d2bs2c_ appears in the current release, SCOPe 2.08