![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
![]() | Protein automated matches [231466] (5 species) not a true protein |
![]() | Species Wolinella succinogenes [TaxId:844] [255061] (1 PDB entry) |
![]() | Domain d2bs2b2: 2bs2 B:1-106 [129034] Other proteins in same PDB: d2bs2a1, d2bs2a2, d2bs2a3, d2bs2b1, d2bs2c_, d2bs2d1, d2bs2d2, d2bs2d3, d2bs2e1, d2bs2f_ automated match to d2bs2b2 complexed with f3s, fad, fes, fum, hem, lmt, na, sf4 |
PDB Entry: 2bs2 (more details), 1.78 Å
SCOPe Domain Sequences for d2bs2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bs2b2 d.15.4.2 (B:1-106) automated matches {Wolinella succinogenes [TaxId: 844]} mgrmltirvfkydpqsavskphfqeykieeapsmtifivlnmiretydpdlnfdfvcrag icgscgmmingrpslacrtltkdfedgvitllplpafklikdlsvd
Timeline for d2bs2b2: