SCOPe 2.01: Domain d2bocc1: 2boc C:22-124

Lineage for d2bocc1 (2boc C:22-124)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein Potassium channel protein [56901] (2 species)

7. Species Streptomyces coelicolor [TaxId:1902] [56902] (26 PDB entries)
   identical sequence to Streptomyces lividans, TaxId: 1916
   Uniprot Q54397 22-124

8. Domain d2bocc1: 2boc C:22-124 [128908]
   automatically matched to d1k4cc_
   complexed with co, t1a, tl

Details for d2bocc1

PDB Entry: 2boc, 3.01 Å

PDB Description: potassium channel kcsa-fab complex in thallium with tetraethylarsonium (teas)

PDB Compounds: (C:) potassium channel kcsa

SCOPe Domain Sequences for d2bocc1:

Sequence; same for both SEQRES and ATOM records:

>d2bocc1 f.14.1.1 (C:22-124) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d2bocc1:

• d2bocc1 first appeared in SCOP 1.73
  
• d2bocc1 appears in SCOP 1.75
  
• d2bocc1 appears in SCOPe 2.02
  
• d2bocc1 appears in the current release, SCOPe 2.08, called d2bocc_