![]() | Class f: Membrane and cell surface proteins and peptides [56835] (50 folds) |
![]() | Fold f.14: Voltage-gated potassium channels [81325] (1 superfamily) oligomeric transmembrane alpha-helical proteins |
![]() | Superfamily f.14.1: Voltage-gated potassium channels [81324] (1 family) ![]() |
![]() | Family f.14.1.1: Voltage-gated potassium channels [81323] (5 proteins) |
![]() | Protein Potassium channel protein [56901] (1 species) |
![]() | Species Streptomyces coelicolor [TaxId:1902] [56902] (27 PDB entries) identical sequence to Streptomyces lividans, TaxId: 1916 |
![]() | Domain d2bocc1: 2boc C:22-124 [128908] automatically matched to d1k4cc_ complexed with co, t1a, tl; mutant |
PDB Entry: 2boc (more details), 3.01 Å
SCOP Domain Sequences for d2bocc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bocc1 f.14.1.1 (C:22-124) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh
Timeline for d2bocc1: