SCOPe 2.08: Domain d2bocc_: 2boc C:

Lineage for d2bocc_ (2boc C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families)
   Pfam PF00520

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein automated matches [190184] (3 species)
   not a true protein

7. Species Streptomyces lividans [TaxId:1916] [186922] (11 PDB entries)

8. Domain d2bocc_: 2boc C: [128908]
   Other proteins in same PDB: d2boca1, d2boca2, d2bocb1, d2bocb2
   automated match to d1r3jc_
   complexed with co, t1a, tl

Details for d2bocc_

PDB Entry: 2boc, 3.01 Å

PDB Description: potassium channel kcsa-fab complex in thallium with tetraethylarsonium (teas)

PDB Compounds: (C:) potassium channel kcsa

SCOPe Domain Sequences for d2bocc_:

Sequence; same for both SEQRES and ATOM records:

>d2bocc_ f.14.1.1 (C:) automated matches {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvetattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

Timeline for d2bocc_:

• d2bocc_ first appeared in SCOP 1.73, called d2bocc1
  
• d2bocc_ appears in SCOPe 2.07