SCOPe 2.02: Domain d2bkqd_: 2bkq D:

Lineage for d2bkqd_ (2bkq D:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (23 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.7: Adenain-like [54054] (6 proteins)
   Pfam PF02902; Ulp1 protease family

6. Protein automated matches [190219] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186979] (4 PDB entries)

8. Domain d2bkqd_: 2bkq D: [128709]
   Other proteins in same PDB: d2bkqa1
   automated match to d1xt9a_

Details for d2bkqd_

PDB Entry: 2bkq, 2 Å

PDB Description: nedd8 protease

PDB Compounds: (D:) Sentrin-specific protease 8

SCOPe Domain Sequences for d2bkqd_:

Sequence; same for both SEQRES and ATOM records:

>d2bkqd_ d.3.1.7 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtqf
ikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhydsh
srsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffrq
qtesllqlltpayitkkrgewkdliatlakk

Timeline for d2bkqd_:

• d2bkqd_ first appeared in SCOP 1.73, called d2bkqd1
  
• d2bkqd_ appears in SCOPe 2.01
  
• d2bkqd_ appears in SCOPe 2.03
  
• d2bkqd_ appears in the current release, SCOPe 2.08