![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (23 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.7: Adenain-like [54054] (6 proteins) Pfam PF02902; Ulp1 protease family |
![]() | Protein Sentrin-specific protease 8, SENP8 [117760] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117761] (2 PDB entries) Uniprot Q96LD8 |
![]() | Domain d2bkqa1: 2bkq A:1-212 [128706] Other proteins in same PDB: d2bkqb_, d2bkqc_, d2bkqd_ |
PDB Entry: 2bkq (more details), 2 Å
SCOPe Domain Sequences for d2bkqa1:
Sequence, based on SEQRES records: (download)
>d2bkqa1 d.3.1.7 (A:1-212) Sentrin-specific protease 8, SENP8 {Human (Homo sapiens) [TaxId: 9606]} mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq fikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhyds hsrsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffr qqtesllqlltpayitkkrgewkdliatlakk
>d2bkqa1 d.3.1.7 (A:1-212) Sentrin-specific protease 8, SENP8 {Human (Homo sapiens) [TaxId: 9606]} mdpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtq fikctsnpaeiamflepldlpnkrvvflaindnsnqaagshwsllvylqdknsffhydsh srsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffrq qtesllqlltpayitkkrgewkdliatlakk
Timeline for d2bkqa1: