Lineage for d2bkqd_ (2bkq D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927257Family d.3.1.7: Adenain-like [54054] (6 proteins)
    Pfam PF02902; Ulp1 protease family
  6. 2927311Protein automated matches [190219] (1 species)
    not a true protein
  7. 2927312Species Human (Homo sapiens) [TaxId:9606] [186979] (5 PDB entries)
  8. 2927317Domain d2bkqd_: 2bkq D: [128709]
    Other proteins in same PDB: d2bkqa1
    automated match to d1xt9a_

Details for d2bkqd_

PDB Entry: 2bkq (more details), 2 Å

PDB Description: nedd8 protease
PDB Compounds: (D:) Sentrin-specific protease 8

SCOPe Domain Sequences for d2bkqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkqd_ d.3.1.7 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dpvvlsymdsllrqsdvslldppswlndhiigfafeyfansqfhdssdhvsfispevtqf
ikctsnpaeiamflepldlpnkrvvflaindnsnqaaggshwsllvylqdknsffhydsh
srsnsvhakqvaekleaflgrkgdklafveekapaqqnsydcgmyvicntealcqnffrq
qtesllqlltpayitkkrgewkdliatlakk

SCOPe Domain Coordinates for d2bkqd_:

Click to download the PDB-style file with coordinates for d2bkqd_.
(The format of our PDB-style files is described here.)

Timeline for d2bkqd_: