SCOPe 2.02: Domain d2bjcb1: 2bjc B:101-162

Lineage for d2bjcb1 (2bjc B:101-162)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
   lacks the first helix of canonical fold
   3 helices; bundle, partly opened, right-handed twist

6. Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)

7. Species Escherichia coli [TaxId:562] [47442] (11 PDB entries)

8. Domain d2bjcb1: 2bjc B:101-162 [128621]
   automatically matched to 2BJC A:1-62
   protein/DNA complex; mutant

Details for d2bjcb1

PDB Entry: 2bjc

PDB Description: nmr structure of a protein-dna complex of an altered specificity mutant of the lac repressor headpiece that mimics the gal repressor

PDB Compounds: (B:) lactose operon repressor

SCOPe Domain Sequences for d2bjcb1:

Sequence; same for both SEQRES and ATOM records:

>d2bjcb1 a.35.1.5 (B:101-162) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsvatvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
sl

Timeline for d2bjcb1:

• d2bjcb1 first appeared in SCOP 1.73
  
• d2bjcb1 appears in SCOPe 2.01
  
• d2bjcb1 appears in SCOPe 2.03
  
• d2bjcb1 appears in the current release, SCOPe 2.08, called d2bjcb_