PDB entry 2bjc

View 2bjc on RCSB PDB site
Description: nmr structure of a protein-DNA complex of an altered specificity mutant of the lac repressor headpiece that mimics the gal repressor
Class: transcription regulator
Keywords: transcription regulator, symmetric DNA-binding, DNA-binding, hth, lac operon, lac repressor, altered specificity, mutant, repressor, transcription regulation, transcription regulator/DNA, nmr, gal repressor, gal operon, lac headpiece, symmetric dimer
Deposited on 2005-02-01, released 2005-10-18
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactose operon repressor
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023
      • engineered mutation (16-17)
      • engineered mutation (51)
    Domains in SCOPe 2.02: d2bjca1
  • Chain 'B':
    Compound: lactose operon repressor
    Species: ESCHERICHIA COLI [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03023 (0-61)
      • engineered mutation (16-17)
      • engineered mutation (51)
    Domains in SCOPe 2.02: d2bjcb1
  • Chain 'C':
    Compound: 5'-d(*gp*ap*ap*tp*tp*gp*tp*ap*ap*gp *cp*gp*cp*tp*tp*ap*cp*ap*ap*tp*tp*c)-3'
  • Chain 'D':
    Compound: 5'-d(*gp*ap*ap*tp*tp*gp*tp*ap*ap*gp *cp*gp*cp*tp*tp*ap*cp*ap*ap*tp*tp*c)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bjcA (A:)
    mkpvtlydvaeyagvsvatvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
    sl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bjcB (B:)
    mkpvtlydvaeyagvsvatvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
    sl
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.