Lineage for d2bjcb1 (2bjc B:101-162)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 640241Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 640242Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families) (S)
  5. 640410Family a.35.1.5: GalR/LacI-like bacterial regulator [47438] (4 proteins)
    lacks the first helix of canonical fold
    3 helices; bundle, partly opened, right-handed twist
  6. 640425Protein Lac repressor (LacR), N-terminal domain [47441] (1 species)
  7. 640426Species Escherichia coli [TaxId:562] [47442] (10 PDB entries)
  8. 640438Domain d2bjcb1: 2bjc B:101-162 [128621]
    automatically matched to 2BJC A:1-62
    mutant

Details for d2bjcb1

PDB Entry: 2bjc (more details)

PDB Description: nmr structure of a protein-dna complex of an altered specificity mutant of the lac repressor headpiece that mimics the gal repressor
PDB Compounds: (B:) lactose operon repressor

SCOP Domain Sequences for d2bjcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjcb1 a.35.1.5 (B:101-162) Lac repressor (LacR), N-terminal domain {Escherichia coli [TaxId: 562]}
mkpvtlydvaeyagvsvatvsrvvnqashvsaktrekveaamaelnyipnrcaqqlagkq
sl

SCOP Domain Coordinates for d2bjcb1:

Click to download the PDB-style file with coordinates for d2bjcb1.
(The format of our PDB-style files is described here.)

Timeline for d2bjcb1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2bjca1