Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.18: ACT-like [55021] (14 families) regulatory domain linked to a wide range of metabolic enzymes |
Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein) |
Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species) |
Species Pyrococcus horikoshii [TaxId:53953] [143375] (5 PDB entries) Uniprot O58316 51-132 |
Domain d2bj9b2: 2bj9 B:51-132 [128619] Other proteins in same PDB: d2bj9a1, d2bj9b1 automatically matched to 2BJ1 A:51-132 complexed with ni, pg4, po4 |
PDB Entry: 2bj9 (more details), 3 Å
SCOPe Domain Sequences for d2bj9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bj9b2 d.58.18.4 (B:51-132) Nickel responsive regulator NikR, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} neevagtitivynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakki kmiadkllslkgvkhgklvmts
Timeline for d2bj9b2: