Lineage for d2bj9b2 (2bj9 B:51-132)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725281Superfamily d.58.18: ACT-like [55021] (12 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 725317Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein)
  6. 725318Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)
  7. 725319Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143375] (5 PDB entries)
  8. 725329Domain d2bj9b2: 2bj9 B:51-132 [128619]
    Other proteins in same PDB: d2bj9a1, d2bj9b1
    automatically matched to 2BJ1 A:51-132
    complexed with ni, pg4, po4

Details for d2bj9b2

PDB Entry: 2bj9 (more details), 3 Å

PDB Description: nikr with bound nickel and phosphate
PDB Compounds: (B:) nickel responsive regulator

SCOP Domain Sequences for d2bj9b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bj9b2 d.58.18.4 (B:51-132) Nickel responsive regulator NikR, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
neevagtitivynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakki
kmiadkllslkgvkhgklvmts

SCOP Domain Coordinates for d2bj9b2:

Click to download the PDB-style file with coordinates for d2bj9b2.
(The format of our PDB-style files is described here.)

Timeline for d2bj9b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bj9b1