| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) ![]() |
| Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins) |
| Protein XPF endonuclease [142447] (1 species) |
| Species Aeropyrum pernix [TaxId:56636] [142448] (2 PDB entries) Uniprot Q9YC15 16-148 |
| Domain d2bhna2: 2bhn A:19-148 [128535] Other proteins in same PDB: d2bhna1, d2bhnb1, d2bhnc1, d2bhnd1 automatically matched to 2BGW A:16-148 |
PDB Entry: 2bhn (more details), 3.2 Å
SCOPe Domain Sequences for d2bhna2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bhna2 c.52.1.20 (A:19-148) XPF endonuclease {Aeropyrum pernix [TaxId: 56636]}
prvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgrl
feqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgtal
vieslarlst
Timeline for d2bhna2: