SCOPe 2.08: Domain d2bhnb2: 2bhn B:19-148

Lineage for d2bhnb2 (2bhn B:19-148)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families)

5. Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins)

6. Protein XPF endonuclease [142447] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [142448] (2 PDB entries)
   Uniprot Q9YC15 16-148

8. Domain d2bhnb2: 2bhn B:19-148 [128537]
   Other proteins in same PDB: d2bhna1, d2bhnb1, d2bhnc1, d2bhnd1
   automatically matched to 2BGW A:16-148

Details for d2bhnb2

PDB Entry: 2bhn, 3.2 Å

PDB Description: xpf from aeropyrum pernix

PDB Compounds: (B:) xpf endonuclease

SCOPe Domain Sequences for d2bhnb2:

Sequence; same for both SEQRES and ATOM records:

>d2bhnb2 c.52.1.20 (B:19-148) XPF endonuclease {Aeropyrum pernix [TaxId: 56636]}
prvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgrl
feqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgtal
vieslarlst

Timeline for d2bhnb2:

• d2bhnb2 first appeared in SCOP 1.73
  
• d2bhnb2 appears in SCOPe 2.07