SCOPe 2.08: Domain d2bhna1: 2bhn A:160-229

Lineage for d2bhna1 (2bhn A:160-229)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.2: RuvA domain 2-like [47781] (7 families)
   duplication: contains two helix-hairpin-helix (HhH) motifs

5. Family a.60.2.5: Hef domain-like [140629] (4 proteins)
   helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft)

6. Protein DNA repair endonuclease XPF [140634] (2 species)

7. Species Aeropyrum pernix [TaxId:56636] [140635] (2 PDB entries)
   Uniprot Q9YC15 160-229

8. Domain d2bhna1: 2bhn A:160-229 [128534]
   Other proteins in same PDB: d2bhna2, d2bhnb2, d2bhnc2, d2bhnd2
   automatically matched to 2BGW A:160-229

Details for d2bhna1

PDB Entry: 2bhn, 3.2 Å

PDB Description: xpf from aeropyrum pernix

PDB Compounds: (A:) xpf endonuclease

SCOPe Domain Sequences for d2bhna1:

Sequence; same for both SEQRES and ATOM records:

>d2bhna1 a.60.2.5 (A:160-229) DNA repair endonuclease XPF {Aeropyrum pernix [TaxId: 56636]}
kprlsdvrewqlyilqsfpgigrrtaerilerfgslerfftaskaeiskvegigekraee
ikkilmtpyk

Timeline for d2bhna1:

• d2bhna1 first appeared in SCOP 1.73
  
• d2bhna1 appears in SCOPe 2.07