| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.11: Cyto-EpsL domain [117644] (1 protein) N-terminal part of Pfam PF05134 |
| Protein Cytoplasmic domain of general secretion pathway protein L, EpsL [117645] (1 species) |
| Species Vibrio cholerae [TaxId:666] [117646] (3 PDB entries) Uniprot P45782 6-244 |
| Domain d2bh1b2: 2bh1 B:2-145 [128509] Other proteins in same PDB: d2bh1x1, d2bh1y_ automatically matched to 1YF5 L:2-145 complexed with ca |
PDB Entry: 2bh1 (more details), 2.4 Å
SCOPe Domain Sequences for d2bh1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bh1b2 c.55.1.11 (B:2-145) Cytoplasmic domain of general secretion pathway protein L, EpsL {Vibrio cholerae [TaxId: 666]}
sefltvrlssqkeadipwlvwsaeqqeviasgqvagwealheiesyadqrsvvvllaasd
liltsveippgasrqlenmlpylledeiaqdvedvhfcvlskgretadvvgvdrlwlrac
ldhlkacgfdvkrvlpdvlaiprp
Timeline for d2bh1b2:
View in 3DDomains from other chains: (mouse over for more information) d2bh1a1, d2bh1a2, d2bh1x1, d2bh1y_ |