Lineage for d2bh1a1 (2bh1 A:146-239)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1171251Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 1171896Family c.55.1.11: Cyto-EpsL domain [117644] (1 protein)
    N-terminal part of Pfam PF05134
  6. 1171897Protein Cytoplasmic domain of general secretion pathway protein L, EpsL [117645] (1 species)
  7. 1171898Species Vibrio cholerae [TaxId:666] [117646] (3 PDB entries)
    Uniprot P45782 6-244
  8. 1171899Domain d2bh1a1: 2bh1 A:146-239 [128506]
    Other proteins in same PDB: d2bh1x1, d2bh1y_
    automatically matched to 1YF5 L:146-239
    complexed with ca

Details for d2bh1a1

PDB Entry: 2bh1 (more details), 2.4 Å

PDB Description: x-ray structure of the general secretion pathway complex of the n-terminal domain of epse and the cytosolic domain of epsl of vibrio cholerae
PDB Compounds: (A:) general secretion pathway protein l

SCOPe Domain Sequences for d2bh1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bh1a1 c.55.1.11 (A:146-239) Cytoplasmic domain of general secretion pathway protein L, EpsL {Vibrio cholerae [TaxId: 666]}
ehglaalqlgdewlvrksttqgmavdaqwlsllaasdwvqnegeylplqaltplpelsla
etqewryepsglvmqlltqealtskfnlltgsfk

SCOPe Domain Coordinates for d2bh1a1:

Click to download the PDB-style file with coordinates for d2bh1a1.
(The format of our PDB-style files is described here.)

Timeline for d2bh1a1: