| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (64 species) not a true protein |
| Species Vibrio cholerae [TaxId:666] [255053] (1 PDB entry) |
| Domain d2bh1a1: 2bh1 A:146-239 [128506] Other proteins in same PDB: d2bh1a2, d2bh1b2, d2bh1x1, d2bh1y_ automated match to d2bh1a1 complexed with ca |
PDB Entry: 2bh1 (more details), 2.4 Å
SCOPe Domain Sequences for d2bh1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bh1a1 c.55.1.0 (A:146-239) automated matches {Vibrio cholerae [TaxId: 666]}
ehglaalqlgdewlvrksttqgmavdaqwlsllaasdwvqnegeylplqaltplpelsla
etqewryepsglvmqlltqealtskfnlltgsfk
Timeline for d2bh1a1:
View in 3DDomains from other chains: (mouse over for more information) d2bh1b1, d2bh1b2, d2bh1x1, d2bh1y_ |