![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Domain d2bh1b2: 2bh1 B:2-145 [128509] Other proteins in same PDB: d2bh1a1, d2bh1b1, d2bh1x1, d2bh1y_ automated match to d2bh1b2 complexed with ca |
PDB Entry: 2bh1 (more details), 2.4 Å
SCOPe Domain Sequences for d2bh1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bh1b2 c.55.1.11 (B:2-145) automated matches {Vibrio cholerae [TaxId: 666]} sefltvrlssqkeadipwlvwsaeqqeviasgqvagwealheiesyadqrsvvvllaasd liltsveippgasrqlenmlpylledeiaqdvedvhfcvlskgretadvvgvdrlwlrac ldhlkacgfdvkrvlpdvlaiprp
Timeline for d2bh1b2:
![]() Domains from other chains: (mouse over for more information) d2bh1a1, d2bh1a2, d2bh1x1, d2bh1y_ |