SCOPe 2.01: Domain d2bgwb2: 2bgw B:18-148

Lineage for d2bgwb2 (2bgw B:18-148)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families)

5. Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins)

6. Protein XPF endonuclease [142447] (1 species)

7. Species Aeropyrum pernix [TaxId:56636] [142448] (2 PDB entries)
   Uniprot Q9YC15 16-148

8. Domain d2bgwb2: 2bgw B:18-148 [128503]
   Other proteins in same PDB: d2bgwa1, d2bgwb1
   automatically matched to 2BGW A:16-148
   protein/DNA complex; complexed with mg, so4

Details for d2bgwb2

PDB Entry: 2bgw, 2.8 Å

PDB Description: xpf from aeropyrum pernix, complex with dna

PDB Compounds: (B:) xpf endonuclease

SCOPe Domain Sequences for d2bgwb2:

Sequence; same for both SEQRES and ATOM records:

>d2bgwb2 c.52.1.20 (B:18-148) XPF endonuclease {Aeropyrum pernix [TaxId: 56636]}
rprvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgr
lfeqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgta
lvieslarlst

Timeline for d2bgwb2:

• d2bgwb2 first appeared in SCOP 1.73
  
• d2bgwb2 appears in SCOP 1.75
  
• d2bgwb2 appears in SCOPe 2.02
  
• d2bgwb2 appears in the current release, SCOPe 2.08