Lineage for d2bgwb2 (2bgw B:18-148)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882594Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins)
  6. 2882606Protein XPF endonuclease [142447] (1 species)
  7. 2882607Species Aeropyrum pernix [TaxId:56636] [142448] (2 PDB entries)
    Uniprot Q9YC15 16-148
  8. 2882609Domain d2bgwb2: 2bgw B:18-148 [128503]
    Other proteins in same PDB: d2bgwa1, d2bgwb1
    automated match to d2bgwa2
    protein/DNA complex; complexed with mg, so4

Details for d2bgwb2

PDB Entry: 2bgw (more details), 2.8 Å

PDB Description: xpf from aeropyrum pernix, complex with dna
PDB Compounds: (B:) xpf endonuclease

SCOPe Domain Sequences for d2bgwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bgwb2 c.52.1.20 (B:18-148) XPF endonuclease {Aeropyrum pernix [TaxId: 56636]}
rprvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgr
lfeqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgta
lvieslarlst

SCOPe Domain Coordinates for d2bgwb2:

Click to download the PDB-style file with coordinates for d2bgwb2.
(The format of our PDB-style files is described here.)

Timeline for d2bgwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bgwb1