Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) |
Family c.52.1.20: XPF/Rad1/Mus81 nuclease [89716] (3 proteins) |
Protein XPF endonuclease [142447] (1 species) |
Species Aeropyrum pernix [TaxId:56636] [142448] (2 PDB entries) Uniprot Q9YC15 16-148 |
Domain d2bgwb2: 2bgw B:18-148 [128503] Other proteins in same PDB: d2bgwa1, d2bgwb1 automatically matched to 2BGW A:16-148 protein/DNA complex; complexed with mg, so4 |
PDB Entry: 2bgw (more details), 2.8 Å
SCOPe Domain Sequences for d2bgwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bgwb2 c.52.1.20 (B:18-148) XPF endonuclease {Aeropyrum pernix [TaxId: 56636]} rprvyvdvreerspvpsileslgvqvipkqlpmgdylvsdsiiverktssdfakslfdgr lfeqasrlaehyetvfiivegppvprryrgrerslyaamaalqldygirlmntmdpkgta lvieslarlst
Timeline for d2bgwb2: