Lineage for d2beib_ (2bei B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533278Protein Diamine acetyltransferase 2 [143688] (1 species)
  7. 2533279Species Human (Homo sapiens) [TaxId:9606] [143689] (2 PDB entries)
    Uniprot Q96F10 3-169
  8. 2533283Domain d2beib_: 2bei B: [128380]
    automated match to d2beia1
    complexed with aco

Details for d2beib_

PDB Entry: 2bei (more details), 1.84 Å

PDB Description: x-ray structure of thialysine n-acetyltransferase (ssat2) from homo sapiens
PDB Compounds: (B:) Diamine acetyltransferase 2

SCOPe Domain Sequences for d2beib_:

Sequence, based on SEQRES records: (download)

>d2beib_ d.108.1.1 (B:) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]}
asvrireakegdcgdilrlirelaefeklsdqvkiseealradgfgdnpfyhclvaeilp
apgkllgpcvvgygiyyfiystwkgrtiylediyvmpeyrgqgigskiikkvaevaldkg
csqfrlavldwnqramdlykalgaqdlteaegwhffcfqgeatrklagk

Sequence, based on observed residues (ATOM records): (download)

>d2beib_ d.108.1.1 (B:) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]}
asvrireakegdcgdilrlirelaefeklsdqvkiseealradgfgdnpfyhclvaeicv
vgygiyyfiystwkgrtiylediyvmpeyrgqgigskiikkvaevaldkgcsqfrlavld
wnqramdlykalgaqdlteaegwhffcfqgeatrklagk

SCOPe Domain Coordinates for d2beib_:

Click to download the PDB-style file with coordinates for d2beib_.
(The format of our PDB-style files is described here.)

Timeline for d2beib_: