Lineage for d2beia1 (2bei A:3-169)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. Protein Diamine acetyltransferase 2 [143688] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [143689] (2 PDB entries)
    Uniprot Q96F10 3-169
  8. Domain d2beia1: 2bei A:3-169 [128379]
    complexed with aco

Details for d2beia1

PDB Entry: 2bei (more details), 1.84 Å

PDB Description: x-ray structure of thialysine n-acetyltransferase (ssat2) from homo sapiens
PDB Compounds: (A:) Diamine acetyltransferase 2

SCOPe Domain Sequences for d2beia1:

Sequence, based on SEQRES records: (download)

>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]}
svrireakegdcgdilrlirelaefeklsdqvkiseealradgfgdnpfyhclvaeilpa
pgkllgpcvvgygiyyfiystwkgrtiylediyvmpeyrgqgigskiikkvaevaldkgc
sqfrlavldwnqramdlykalgaqdlteaegwhffcfqgeatrklag

Sequence, based on observed residues (ATOM records): (download)

>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]}
svrireakegdcgdilrlirelaefeklkiseealradgfgdnpfyhclvaeilgpcvvg
ygiyyfiystwkgrtiylediyvmpeyrgqgigskiikkvaevaldkgcsqfrlavldwn
qramdlykalgaqdlteaegwhffcfqgeatrklag

SCOPe Domain Coordinates for d2beia1 are not available.

Timeline for d2beia1:

Domains from other chains:
(mouse over for more information)
d2beib_