PDB entry 2bei

View 2bei on RCSB PDB site
Description: X-ray structure of thialysine n-acetyltransferase (SSAT2) from homo sapiens
Class: transferase
Keywords: ssat2, bc011751, aah11751, thialysine n-acetyltransferase, structural genomics, protein structure initiative, psi, center for eukaryotic structural genomics, cesg, transferase
Deposited on 2005-10-24, released 2005-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diamine acetyltransferase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SAT2, SSAT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96F10
      • modified residue (96)
      • modified residue (136)
    Domains in SCOPe 2.08: d2beia1
  • Chain 'B':
    Compound: Diamine acetyltransferase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SAT2, SSAT2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96F10 (1-169)
      • modified residue (96)
      • modified residue (136)
    Domains in SCOPe 2.08: d2beib_
  • Heterogens: ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2beiA (A:)
    sasvrireakegdcgdilrlirelaefeklsdqvkiseealradgfgdnpfyhclvaeil
    papgkllgpcvvgygiyyfiystwkgrtiylediyvmpeyrgqgigskiikkvaevaldk
    gcsqfrlavldwnqramdlykalgaqdlteaegwhffcfqgeatrklagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2beiA (A:)
    svrireakegdcgdilrlirelaefeklkiseealradgfgdnpfyhclvaeilgpcvvg
    ygiyyfiystwkgrtiylediyvmpeyrgqgigskiikkvaevaldkgcsqfrlavldwn
    qramdlykalgaqdlteaegwhffcfqgeatrklag
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2beiB (B:)
    sasvrireakegdcgdilrlirelaefeklsdqvkiseealradgfgdnpfyhclvaeil
    papgkllgpcvvgygiyyfiystwkgrtiylediyvmpeyrgqgigskiikkvaevaldk
    gcsqfrlavldwnqramdlykalgaqdlteaegwhffcfqgeatrklagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2beiB (B:)
    asvrireakegdcgdilrlirelaefeklsdqvkiseealradgfgdnpfyhclvaeicv
    vgygiyyfiystwkgrtiylediyvmpeyrgqgigskiikkvaevaldkgcsqfrlavld
    wnqramdlykalgaqdlteaegwhffcfqgeatrklagk