SCOPe 2.08: Domain d2bedb_: 2bed B:

Lineage for d2bedb_ (2bed B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)

6. Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [48248] (50 PDB entries)
   Uniprot Q02293 22-418 P53610

8. Domain d2bedb_: 2bed B: [128376]
   Other proteins in same PDB: d2beda_
   automated match to d1d8db_
   complexed with 736, fpp, zn

Details for d2bedb_

PDB Entry: 2bed, 2.7 Å

PDB Description: structure of fpt bound to inhibitor sch207736

PDB Compounds: (B:) Protein farnesyltransferase beta subunit

SCOPe Domain Sequences for d2bedb_:

Sequence; same for both SEQRES and ATOM records:

>d2bedb_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlqrekhfhyl
krglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcqspdggfgg
gpgqyphlaptyaavnalciigteeaynvinrekllqylyslkqpdgsflmhvggevdvr
saycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfcglaalvil
kkerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhralhaqgdpa
lsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaqhfgsgaml
hdvvmgvpenvlqpthpvynigpdkviqatthflqkpvpgf

Timeline for d2bedb_:

• d2bedb_ first appeared in SCOP 1.73, called d2bedb1
  
• d2bedb_ appears in SCOPe 2.07