| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
| Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
| Protein Protein phosphatase-1 (PP-1) [56311] (5 species) |
| Species Human (Homo sapiens), beta isoform [TaxId:9606] [64430] (7 PDB entries) Uniprot P36873 |
| Domain d2bdxa_: 2bdx A: [128346] automated match to d1jk7a_ complexed with mn |
PDB Entry: 2bdx (more details), 2.3 Å
SCOPe Domain Sequences for d2bdxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bdxa_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]}
klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkp
Timeline for d2bdxa_: