SCOP 1.73: Domain d2bdxa1: 2bdx A:6-298

Lineage for d2bdxa1 (2bdx A:6-298)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (10 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (5 proteins)

6. Protein Protein phosphatase-1 (PP-1) [56311] (3 species)

7. Species Human (Homo sapiens), beta isoform [TaxId:9606] [64430] (5 PDB entries)

8. Domain d2bdxa1: 2bdx A:6-298 [128346]
   automatically matched to d1jk7a_
   complexed with dlq, mn

Details for d2bdxa1

PDB Entry: 2bdx, 2.3 Å

PDB Description: X-ray Crystal Structure of dihydromicrocystin-LA bound to Protein Phosphatase-1

PDB Compounds: (A:) serine/threonine protein phosphatase pp1-gamma catalytic subunit

SCOP Domain Sequences for d2bdxa1:

Sequence; same for both SEQRES and ATOM records:

>d2bdxa1 d.159.1.3 (A:6-298) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]}
klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkp

Timeline for d2bdxa1:

• d2bdxa1 is new in SCOP 1.73
  
• d2bdxa1 appears in SCOP 1.75
  
• d2bdxa1 appears in the current release, SCOPe 2.08, called d2bdxa_