Lineage for d2bdxa_ (2bdx A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2603960Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2603961Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2604064Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2604090Protein Protein phosphatase-1 (PP-1) [56311] (6 species)
  7. 2604101Species Human (Homo sapiens), beta isoform [TaxId:9606] [64430] (7 PDB entries)
    Uniprot P36873
  8. 2604107Domain d2bdxa_: 2bdx A: [128346]
    automated match to d1jk7a_
    complexed with mn

Details for d2bdxa_

PDB Entry: 2bdx (more details), 2.3 Å

PDB Description: X-ray Crystal Structure of dihydromicrocystin-LA bound to Protein Phosphatase-1
PDB Compounds: (A:) serine/threonine protein phosphatase pp1-gamma catalytic subunit

SCOPe Domain Sequences for d2bdxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bdxa_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]}
klnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdi
hgqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnh
ecasinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeq
irrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlic
rahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkp

SCOPe Domain Coordinates for d2bdxa_:

Click to download the PDB-style file with coordinates for d2bdxa_.
(The format of our PDB-style files is described here.)

Timeline for d2bdxa_: