![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
![]() | Superfamily f.17.3: Magnesium transport protein CorA, transmembrane region [144083] (1 family) ![]() forms homopentameric channel |
![]() | Family f.17.3.1: Magnesium transport protein CorA, transmembrane region [144084] (1 protein) C-terminal part of Pfam PF01544 |
![]() | Protein Magnesium transport protein CorA [144085] (2 species) |
![]() | Species Thermotoga maritima [TaxId:2336] [144086] (3 PDB entries) Uniprot Q9WZ31 286-349 |
![]() | Domain d2bbjb2: 2bbj B:286-349 [128270] Other proteins in same PDB: d2bbja1, d2bbjb1, d2bbjd1, d2bbje1, d2bbjf1 automatically matched to 2BBJ A:286-349 |
PDB Entry: 2bbj (more details), 3.9 Å
SCOPe Domain Sequences for d2bbjb2:
Sequence, based on SEQRES records: (download)
>d2bbjb2 f.17.3.1 (B:286-349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]} ktnevmkvltiiatifmpltfiagiygmnfeympelrwkwgypvvlavmgviavimvvyf kkkk
>d2bbjb2 f.17.3.1 (B:286-349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]} ktnevmkvltiiatifmpltfiagiygmnfwkwgypvvlavmgviavimvvyfkkkk
Timeline for d2bbjb2: