Lineage for d2bbja2 (2bbj A:286-349)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3024193Superfamily f.17.3: Magnesium transport protein CorA, transmembrane region [144083] (1 family) (S)
    forms homopentameric channel
  5. 3024194Family f.17.3.1: Magnesium transport protein CorA, transmembrane region [144084] (1 protein)
    C-terminal part of Pfam PF01544
  6. 3024195Protein Magnesium transport protein CorA [144085] (2 species)
  7. 3024196Species Thermotoga maritima [TaxId:2336] [144086] (3 PDB entries)
    Uniprot Q9WZ31 286-349
  8. 3024212Domain d2bbja2: 2bbj A:286-349 [128268]
    Other proteins in same PDB: d2bbja1, d2bbjb1, d2bbjd1, d2bbje1, d2bbjf1

Details for d2bbja2

PDB Entry: 2bbj (more details), 3.9 Å

PDB Description: Crystal structure of the CorA Mg2+ transporter
PDB Compounds: (A:) divalent cation transport-related protein

SCOPe Domain Sequences for d2bbja2:

Sequence, based on SEQRES records: (download)

>d2bbja2 f.17.3.1 (A:286-349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]}
ktnevmkvltiiatifmpltfiagiygmnfeympelrwkwgypvvlavmgviavimvvyf
kkkk

Sequence, based on observed residues (ATOM records): (download)

>d2bbja2 f.17.3.1 (A:286-349) Magnesium transport protein CorA {Thermotoga maritima [TaxId: 2336]}
ktnevmkvltiiatifmpltfiagiygmnfwkwgypvvlavmgviavimvvyfkkkk

SCOPe Domain Coordinates for d2bbja2:

Click to download the PDB-style file with coordinates for d2bbja2.
(The format of our PDB-style files is described here.)

Timeline for d2bbja2: