Lineage for d2bbjd1 (2bbj D:9-285)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011079Fold d.328: CorA soluble domain-like [143864] (1 superfamily)
    beta(2)-alpha-beta-alpha(2)-beta(4)-alpha(3); 3 layers: a/b/a; mixed beta-sheet, order 2137654; strands 3 and 7 are parallel
  4. 3011080Superfamily d.328.1: CorA soluble domain-like [143865] (1 family) (S)
  5. 3011081Family d.328.1.1: CorA soluble domain-like [143866] (2 proteins)
    N-terminal part of Pfam PF01544
  6. 3011082Protein Magnesium transport protein CorA, soluble domain [143867] (1 species)
  7. 3011083Species Thermotoga maritima [TaxId:2336] [143868] (3 PDB entries)
    Uniprot Q9WZ31 13-244! Uniprot Q9WZ31 9-285
  8. 3011092Domain d2bbjd1: 2bbj D:9-285 [128271]
    Other proteins in same PDB: d2bbja2, d2bbjb2, d2bbjd2, d2bbje2, d2bbjf2
    automatically matched to 2BBJ A:9-285

Details for d2bbjd1

PDB Entry: 2bbj (more details), 3.9 Å

PDB Description: Crystal structure of the CorA Mg2+ transporter
PDB Compounds: (D:) divalent cation transport-related protein

SCOPe Domain Sequences for d2bbjd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bbjd1 d.328.1.1 (D:9-285) Magnesium transport protein CorA, soluble domain {Thermotoga maritima [TaxId: 2336]}
kkglppgtlvytgkyredfeievmnysieefrefkttdvesvlpfrdsstptwinitgih
rtdvvqrvgeffgihplvledilnvhqrpkveffenyvfivlkmftydknlheleseqvs
liltkncvlmfqekigdvfdpvrerirynrgiirkkradyllyslidalvddyfvlleki
ddeidvleeevlerpeketvqrthqlkrnlvelrktiwplrevlsslyrdvpplieketv
pyfrdvydhtiqiadtvetfrdivsglldvylssvsn

SCOPe Domain Coordinates for d2bbjd1:

Click to download the PDB-style file with coordinates for d2bbjd1.
(The format of our PDB-style files is described here.)

Timeline for d2bbjd1: