SCOPe 2.08: Domain d2b9ni1: 2b9n I:56-149

Lineage for d2b9ni1 (2b9n I:56-149)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.99: Ribosomal protein L9 C-domain [55652] (1 superfamily)
   alpha-beta-alpha(2)-beta(2); 2 layers: alpha/beta

4. Superfamily d.99.1: Ribosomal protein L9 C-domain [55653] (1 family)
   automatically mapped to Pfam PF03948

5. Family d.99.1.1: Ribosomal protein L9 C-domain [55654] (1 protein)

6. Protein Ribosomal protein L9 C-domain [55655] (3 species)

7. Species Thermus thermophilus [TaxId:274] [143635] (9 PDB entries)
   Uniprot Q5SLQ1 55-146

8. Domain d2b9ni1: 2b9n I:56-149 [128151]
   Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1

Details for d2b9ni1

PDB Entry: 2b9n, 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.

PDB Compounds: (I:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2b9ni1:

Sequence, based on SEQRES records:

>d2b9ni1 d.99.1.1 (I:56-149) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
rqaaeelanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrki
eladairalgytnvpvklhpevtatlkvhvteqk

Sequence, based on observed residues (ATOM records):

>d2b9ni1 d.99.1.1 (I:56-149) Ribosomal protein L9 C-domain {Thermus thermophilus [TaxId: 274]}
rqaaeelanakklkeqlekltvtipakagegrlfgsitskqiaeslqaqhglkldkrkie
ladairalgytnvpvklhpevtatlkvhvteqk

Timeline for d2b9ni1:

• d2b9ni1 first appeared in SCOP 1.73
  
• d2b9ni1 appears in SCOPe 2.07