![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.59: Ribosomal protein L30p/L7e [55128] (1 superfamily) core: beta-alpha-beta-alpha-beta; antiparallel beta-sheet: order 312; some similarity to the ferredoxin-like fold |
![]() | Superfamily d.59.1: Ribosomal protein L30p/L7e [55129] (1 family) ![]() |
![]() | Family d.59.1.1: Ribosomal protein L30p/L7e [55130] (2 proteins) |
![]() | Protein Prokaryotic ribosomal protein L30 [55131] (3 species) short-chain member of the family |
![]() | Species Thermus thermophilus [TaxId:274] [55132] (11 PDB entries) |
![]() | Domain d2b9n31: 2b9n 3:1-60 [128147] Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9nn1, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1 |
PDB Entry: 2b9n (more details), 6.76 Å
SCOPe Domain Sequences for d2b9n31:
Sequence; same for both SEQRES and ATOM records: (download)
>d2b9n31 d.59.1.1 (3:1-60) Prokaryotic ribosomal protein L30 {Thermus thermophilus [TaxId: 274]} mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve
Timeline for d2b9n31: