SCOPe 2.08: Domain d2b9nn1: 2b9n N:4-141

Lineage for d2b9nn1 (2b9n N:4-141)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.21: Ribosomal protein L13 [52160] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.21.1: Ribosomal protein L13 [52161] (1 family)

5. Family c.21.1.1: Ribosomal protein L13 [52162] (1 protein)

6. Protein Ribosomal protein L13 [52163] (5 species)
   synonym: 50S ribosomal protein L13p, HMAL13

7. Species Thermus thermophilus [TaxId:274] [159473] (14 PDB entries)
   Uniprot P60488 1-139

8. Domain d2b9nn1: 2b9n N:4-141 [128155]
   Other proteins in same PDB: d2b9n01, d2b9n21, d2b9n31, d2b9n51, d2b9n71, d2b9n81, d2b9n91, d2b9nf1, d2b9nh1, d2b9nh2, d2b9ni1, d2b9ni2, d2b9nk1, d2b9nk2, d2b9no1, d2b9nr1, d2b9nt1, d2b9nu1, d2b9nv1, d2b9nw1, d2b9nx1, d2b9ny1, d2b9nz1

Details for d2b9nn1

PDB Entry: 2b9n, 6.76 Å

PDB Description: 50S ribosomal subunit from a crystal structure of release factor RF2, tRNAs and mRNA bound to the ribosome. This file contains the 50S subunit from a crystal structure of release factor RF1, tRNAs and mRNA bound to the ribosome and is described in remark 400.

PDB Compounds: (N:) 50S ribosomal protein L13

SCOPe Domain Sequences for d2b9nn1:

Sequence, based on SEQRES records:

>d2b9nn1 c.21.1.1 (N:4-141) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
lsnikfvtlgeisetlga

Sequence, based on observed residues (ATOM records):

>d2b9nn1 c.21.1.1 (N:4-141) Ribosomal protein L13 {Thermus thermophilus [TaxId: 274]}
aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
gndngyfypkrpdgifkrtirgmlpkkqrgreafesvrvylgnpydtlgeisetlga

Timeline for d2b9nn1:

• d2b9nn1 first appeared in SCOP 1.73
  
• d2b9nn1 appears in SCOPe 2.07